SCOP 1.69: Domain d2hpaa_: 2hpa A:

Lineage for d2hpaa_ (2hpa A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)

6. Protein Prostatic acid phosphatase [53259] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)

8. Domain d2hpaa_: 2hpa A: [33985]

Details for d2hpaa_

PDB Entry: 2hpa, 2.9 Å

PDB Description: structural origins of l(+)-tartrate inhibition of human prostatic acid phosphatase

SCOP Domain Sequences for d2hpaa_:

Sequence; same for both SEQRES and ATOM records:

>d2hpaa_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens)}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

Timeline for d2hpaa_:

• d2hpaa_ first appeared (with stable ids) in SCOP 1.55
  
• d2hpaa_ appears in SCOP 1.67
  
• d2hpaa_ appears in SCOP 1.71
  
• d2hpaa_ appears in the current release, SCOPe 2.08