Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries) |
Domain d5ofla1: 5ofl A:1-336 [339845] Other proteins in same PDB: d5ofla2 automated match to d4w8la_ complexed with bgc, mpd, so4 |
PDB Entry: 5ofl (more details), 1.87 Å
SCOPe Domain Sequences for d5ofla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofla1 c.1.8.0 (A:1-336) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]} pdwnipslyesykndfrigvaipakclsndtdrrmvlkhfnsitaenemkpesllagqts tglnyrfstadtfvdfantnnigirghtlvwhsqtpdwffkdssgqrltkdallarlkqy iydvvgrykgkvyawdvvnqaidenqsdgyrrstwyeicgpeyiekafiwaheadpnakl fyndynteiskkrdfiynmvknlkskgipihgigmqchinvnwpsvseiensiklfssip gieihitqldmslynygssenystppqdllqkqaqkykelftmlkkytnvvkcvtfwglk ddyswlrsfngkndwplllfedysakpaywavieas
Timeline for d5ofla1: