SCOPe 2.06: Domain d5ofla1: 5ofl A:1-336

Lineage for d5ofla1 (5ofl A:1-336)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries)

8. Domain d5ofla1: 5ofl A:1-336 [339845]
   Other proteins in same PDB: d5ofla2
   automated match to d4w8la_
   complexed with bgc, mpd, so4

Details for d5ofla1

PDB Entry: 5ofl, 1.87 Å

PDB Description: crystal structure of cbxyn10c variant e140q/e248q complexed with cellohexaose

PDB Compounds: (A:) Glycoside hydrolase family 48

SCOPe Domain Sequences for d5ofla1:

Sequence; same for both SEQRES and ATOM records:

>d5ofla1 c.1.8.0 (A:1-336) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
pdwnipslyesykndfrigvaipakclsndtdrrmvlkhfnsitaenemkpesllagqts
tglnyrfstadtfvdfantnnigirghtlvwhsqtpdwffkdssgqrltkdallarlkqy
iydvvgrykgkvyawdvvnqaidenqsdgyrrstwyeicgpeyiekafiwaheadpnakl
fyndynteiskkrdfiynmvknlkskgipihgigmqchinvnwpsvseiensiklfssip
gieihitqldmslynygssenystppqdllqkqaqkykelftmlkkytnvvkcvtfwglk
ddyswlrsfngkndwplllfedysakpaywavieas

Timeline for d5ofla1:

• d5ofla1 is new in SCOPe 2.06-stable
  
• d5ofla1 appears in SCOPe 2.07
  
• d5ofla1 appears in the current release, SCOPe 2.08