![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (47 species) not a true protein |
![]() | Species Photorhabdus luminescens [TaxId:29488] [339816] (2 PDB entries) |
![]() | Domain d5ofid_: 5ofi D: [339831] automated match to d4ywaa_ complexed with 9tq, ca |
PDB Entry: 5ofi (more details), 2 Å
SCOPe Domain Sequences for d5ofid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofid_ b.18.1.0 (D:) automated matches {Photorhabdus luminescens [TaxId: 29488]} sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl k
Timeline for d5ofid_: