Lineage for d1rpa__ (1rpa -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588092Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 588093Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 588145Family c.60.1.2: Histidine acid phosphatase [53258] (3 proteins)
  6. 588169Protein Prostatic acid phosphatase [53259] (2 species)
  7. 588187Species Rat (Rattus norvegicus) [TaxId:10116] [53260] (2 PDB entries)
  8. 588188Domain d1rpa__: 1rpa - [33983]
    complexed with man, nag, tar

Details for d1rpa__

PDB Entry: 1rpa (more details), 3 Å

PDB Description: three-dimensional structure of rat acid phosphatase in complex with l(+) tartrate

SCOP Domain Sequences for d1rpa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpa__ c.60.1.2 (-) Prostatic acid phosphatase {Rat (Rattus norvegicus)}
kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
netqnepypltlpgcthscplekfaelldpvipqdwatecmg

SCOP Domain Coordinates for d1rpa__:

Click to download the PDB-style file with coordinates for d1rpa__.
(The format of our PDB-style files is described here.)

Timeline for d1rpa__: