SCOPe 2.08: Domain d5ngra_: 5ngr A:

Lineage for d5ngra_ (5ngr A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)

8. Domain d5ngra_: 5ngr A: [339811]
   automated match to d3zr0b_
   complexed with 8wt, so4
   has additional insertions and/or extensions that are not grouped together

Details for d5ngra_

PDB Entry: 5ngr, 2.2 Å

PDB Description: crystal structure of human mth1 in complex with fragment inhibitor 8- (methylsulfanyl)-7h-purin-6-amine

PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5ngra_:

Sequence; same for both SEQRES and ATOM records:

>d5ngra_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d5ngra_:

• d5ngra_ first appeared in SCOPe 2.06
  
• d5ngra_ appears in SCOPe 2.07