SCOPe 2.06: Domain d5o05d_: 5o05 D:

Lineage for d5o05d_ (5o05 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)

8. Domain d5o05d_: 5o05 D: [339808]
   automated match to d4ldeb_
   complexed with edo

Details for d5o05d_

PDB Entry: 5o05, 2 Å

PDB Description: gii.10 vietnam 026 norovirus protruding domain in complex with nanobody nano-42

PDB Compounds: (D:) Nanobody (VHH) Nano-42

SCOPe Domain Sequences for d5o05d_:

Sequence, based on SEQRES records:

>d5o05d_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlqesggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnya
dslkgrftisrenaentvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

Sequence, based on observed residues (ATOM records):

>d5o05d_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlqesggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnya
dslkgrftisrntvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

Timeline for d5o05d_:

• d5o05d_ is new in SCOPe 2.06-stable
  
• d5o05d_ is called d5o05d1 in SCOPe 2.07
  
• d5o05d_ appears in the current release, SCOPe 2.08, called d5o05d1