SCOPe 2.08: Domain d5mw6b_: 5mw6 B:

Lineage for d5mw6b_ (5mw6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries)

8. Domain d5mw6b_: 5mw6 B: [339806]
   automated match to d1r2ba_
   complexed with rc0
   has additional insertions and/or extensions that are not grouped together

Details for d5mw6b_

PDB Entry: 5mw6, 1.65 Å

PDB Description: crystal structure of the bcl6 btb-domain with compound 1

PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d5mw6b_:

Sequence; same for both SEQRES and ATOM records:

>d5mw6b_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
iqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlkrn
lsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfika

Timeline for d5mw6b_:

• d5mw6b_ first appeared in SCOPe 2.06
  
• d5mw6b_ appears in SCOPe 2.07