Lineage for d5nstc2 (5nst C:108-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751091Domain d5nstc2: 5nst C:108-208 [339805]
    Other proteins in same PDB: d5nsta1, d5nstc1
    automated match to d1tqbc2
    complexed with gol, nag

Details for d5nstc2

PDB Entry: 5nst (more details), 2.52 Å

PDB Description: human monoclonal antibody with a lair1 insertion
PDB Compounds: (C:) Light Chain of antibody MGD21

SCOPe Domain Sequences for d5nstc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nstc2 b.1.1.2 (C:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivks

SCOPe Domain Coordinates for d5nstc2:

Click to download the PDB-style file with coordinates for d5nstc2.
(The format of our PDB-style files is described here.)

Timeline for d5nstc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5nstc1