SCOPe 2.06: Domain d5h0ga3: 5h0g A:250-531

Lineage for d5h0ga3 (5h0g A:250-531)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)

8. Domain d5h0ga3: 5h0g A:250-531 [339775]
   Other proteins in same PDB: d5h0ga1, d5h0ga2, d5h0ga4
   automated match to d1qcfa3
   complexed with oou

Details for d5h0ga3

PDB Entry: 5h0g, 1.8 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-n,4-dimethylpentanamide

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h0ga3:

Sequence; same for both SEQRES and ATOM records:

>d5h0ga3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Timeline for d5h0ga3:

• d5h0ga3 is new in SCOPe 2.06-stable
  
• d5h0ga3 appears in SCOPe 2.07
  
• d5h0ga3 appears in the current release, SCOPe 2.08