Lineage for d5h0ga2 (5h0g A:147-249)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206697Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2206698Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2206705Domain d5h0ga2: 5h0g A:147-249 [339774]
    Other proteins in same PDB: d5h0ga1, d5h0ga3, d5h0ga4
    automated match to d1qcfa2
    complexed with oou

Details for d5h0ga2

PDB Entry: 5h0g (more details), 1.8 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-n,4-dimethylpentanamide
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h0ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0ga2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d5h0ga2:

Click to download the PDB-style file with coordinates for d5h0ga2.
(The format of our PDB-style files is described here.)

Timeline for d5h0ga2: