SCOPe 2.06: Domain d6ehpb_: 6ehp B:

Lineage for d6ehpb_ (6ehp B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein automated matches [190414] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187290] (9 PDB entries)

8. Domain d6ehpb_: 6ehp B: [339756]
   automated match to d1szva_
   complexed with cl

Details for d6ehpb_

PDB Entry: 6ehp, 2.3 Å

PDB Description: the crystal structure of the human lamtor complex

PDB Compounds: (B:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d6ehpb_:

Sequence, based on SEQRES records:

>d6ehpb_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqa
fnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqv

Sequence, based on observed residues (ATOM records):

>d6ehpb_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqd
nlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqv

Timeline for d6ehpb_:

• d6ehpb_ is new in SCOPe 2.06-stable
  
• d6ehpb_ appears in SCOPe 2.07
  
• d6ehpb_ appears in the current release, SCOPe 2.08