Lineage for d6ehrb_ (6ehr B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577625Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2577626Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2577657Protein automated matches [190414] (3 species)
    not a true protein
  7. 2577667Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. 2577683Domain d6ehrb_: 6ehr B: [339754]
    automated match to d1szva_

Details for d6ehrb_

PDB Entry: 6ehr (more details), 2.9 Å

PDB Description: the crystal structure of the human lamtor-raga ctd-ragc ctd complex
PDB Compounds: (B:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d6ehrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehrb_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mglrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrn
gnqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepl
tqvaas

SCOPe Domain Coordinates for d6ehrb_:

Click to download the PDB-style file with coordinates for d6ehrb_.
(The format of our PDB-style files is described here.)

Timeline for d6ehrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ehra_