Lineage for d5xs4a1 (5xs4 A:71-290)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087284Species Coxsackievirus a6 [TaxId:86107] [339715] (1 PDB entry)
  8. 2087285Domain d5xs4a1: 5xs4 A:71-290 [339741]
    Other proteins in same PDB: d5xs4c_
    automated match to d5abja_

Details for d5xs4a1

PDB Entry: 5xs4 (more details), 3.1 Å

PDB Description: structure of coxsackievirus a6 (cva6) virus a-particle
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5xs4a1:

Sequence, based on SEQRES records: (download)

>d5xs4a1 b.121.4.0 (A:71-290) automated matches {Coxsackievirus a6 [TaxId: 86107]}
vneasvehfysraglvgvvevkdsgtsldgytvwpidvmgfvqqrrklelstymrfdaef
tfvsnlsnsttpgmllqymyvppgapkpdgrksyqwqtatnpsvfaklsdpppqvsvpfm
spatayqwfydgyptfgehkqatnlqygqcpnnmmghfairtvsesttgknvhvrvymri
khvrawvprplrsqaymvknyptysqtitntatdrasitt

Sequence, based on observed residues (ATOM records): (download)

>d5xs4a1 b.121.4.0 (A:71-290) automated matches {Coxsackievirus a6 [TaxId: 86107]}
vneasvehfysraglvgvvevkdsgtsldgytvwpidvmgfvqqrrklelstymrfdaef
tfvsnlsnsttpgmllqymyvppgapkpdgrksyqwqtatnpsvfaklsdpppqvsvpfm
spatayqwfydgyptnlqygqcpnnmmghfairtvsesttgknvhvrvymrikhvrawvp
rplrsqaymvknyptysqtitntatdrasitt

SCOPe Domain Coordinates for d5xs4a1:

Click to download the PDB-style file with coordinates for d5xs4a1.
(The format of our PDB-style files is described here.)

Timeline for d5xs4a1: