SCOPe 2.08: Domain d5w8ua2: 5w8u A:62-320

Lineage for d5w8ua2 (5w8u A:62-320)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (7 PDB entries)

8. Domain d5w8ua2: 5w8u A:62-320 [339689]
   Other proteins in same PDB: d5w8ua1, d5w8ub1, d5w8ub2, d5w8uc1, d5w8ud1, d5w8ud2
   automated match to d4pt5a2
   complexed with aye, mpd, zn

Details for d5w8ua2

PDB Entry: 5w8u, 2.41 Å

PDB Description: crystal structure of mers-cov papain-like protease in complex with the c-terminal domain of human isg15

PDB Compounds: (A:) ORF1ab

SCOPe Domain Sequences for d5w8ua2:

Sequence; same for both SEQRES and ATOM records:

>d5w8ua2 d.3.1.23 (A:62-320) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssd

Timeline for d5w8ua2:

• d5w8ua2 first appeared in SCOPe 2.06
  
• d5w8ua2 appears in SCOPe 2.07