![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (26 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (82 PDB entries) |
![]() | Domain d5w8tb_: 5w8t B: [339687] Other proteins in same PDB: d5w8ta2, d5w8tc2 automated match to d3phxb_ complexed with aye, mpd, zn |
PDB Entry: 5w8t (more details), 2.76 Å
SCOPe Domain Sequences for d5w8tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w8tb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplge yglkplstvfmnlrlrg
Timeline for d5w8tb_: