Lineage for d5w8tc2 (5w8t C:62-320)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174136Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2174137Protein Papain-like protease PLpro, catalytic domain [310795] (3 species)
  7. 2174144Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311427] (5 PDB entries)
  8. 2174151Domain d5w8tc2: 5w8t C:62-320 [339686]
    Other proteins in same PDB: d5w8ta1, d5w8tb_, d5w8tc1, d5w8td_
    automated match to d4pt5a2
    complexed with aye, mpd, zn

Details for d5w8tc2

PDB Entry: 5w8t (more details), 2.76 Å

PDB Description: crystal structure of mers-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (C:) ORF1ab protein

SCOPe Domain Sequences for d5w8tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w8tc2 d.3.1.23 (C:62-320) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssd

SCOPe Domain Coordinates for d5w8tc2:

Click to download the PDB-style file with coordinates for d5w8tc2.
(The format of our PDB-style files is described here.)

Timeline for d5w8tc2: