Lineage for d5w8tc1 (5w8t C:2-61)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178900Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (5 PDB entries)
  8. 2178907Domain d5w8tc1: 5w8t C:2-61 [339685]
    Other proteins in same PDB: d5w8ta2, d5w8tc2
    automated match to d4pt5a1
    complexed with aye, mpd, zn

Details for d5w8tc1

PDB Entry: 5w8t (more details), 2.76 Å

PDB Description: crystal structure of mers-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (C:) ORF1ab protein

SCOPe Domain Sequences for d5w8tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w8tc1 d.15.1.0 (C:2-61) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

SCOPe Domain Coordinates for d5w8tc1:

Click to download the PDB-style file with coordinates for d5w8tc1.
(The format of our PDB-style files is described here.)

Timeline for d5w8tc1: