SCOPe 2.06: Domain d5vn5c1: 5vn5 C:1-332

Lineage for d5vn5c1 (5vn5 C:1-332)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Sphingobium sp. [TaxId:627192] [339663] (1 PDB entry)

8. Domain d5vn5c1: 5vn5 C:1-332 [339669]
   Other proteins in same PDB: d5vn5c2
   automated match to d4ofca_
   complexed with cl, zn

Details for d5vn5c1

PDB Entry: 5vn5, 1.9 Å

PDB Description: crystal structure of ligy from sphingobium sp. strain syk-6

PDB Compounds: (C:) 2,2',3-trihydroxy-3'-methoxy-5,5'-dicarboxybiphenyl meta-cleavage compound hydrolase

SCOPe Domain Sequences for d5vn5c1:

Sequence; same for both SEQRES and ATOM records:

>d5vn5c1 c.1.9.0 (C:1-332) automated matches {Sphingobium sp. [TaxId: 627192]}
miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
iapfiqkfdflsdadkklifednarkvfnlev

Timeline for d5vn5c1:

• d5vn5c1 is new in SCOPe 2.06-stable
  
• d5vn5c1 appears in SCOPe 2.07
  
• d5vn5c1 appears in the current release, SCOPe 2.08