SCOPe 2.06: Domain d5up9f_: 5up9 F:

Lineage for d5up9f_ (5up9 F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries)

8. Domain d5up9f_: 5up9 F: [339666]
   automated match to d4ml5a_
   complexed with byx, peg, pge, zn

Details for d5up9f_

PDB Entry: 5up9, 2.45 Å

PDB Description: crystal structure of zn-bound human heavy-chain ferritin variant 122h- delta c-star with para-xylenedihydroxamate

PDB Compounds: (F:) ferritin heavy chain

SCOPe Domain Sequences for d5up9f_:

Sequence; same for both SEQRES and ATOM records:

>d5up9f_ a.25.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahd
kndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd

Timeline for d5up9f_:

• d5up9f_ is new in SCOPe 2.06-stable
  
• d5up9f_ appears in SCOPe 2.07
  
• d5up9f_ appears in the current release, SCOPe 2.08