Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Sphingobium sp. [TaxId:627192] [339663] (5 PDB entries) |
Domain d5vn5a_: 5vn5 A: [339664] Other proteins in same PDB: d5vn5c2 automated match to d4ofca_ complexed with cl, zn |
PDB Entry: 5vn5 (more details), 1.9 Å
SCOPe Domain Sequences for d5vn5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vn5a_ c.1.9.0 (A:) automated matches {Sphingobium sp. [TaxId: 627192]} miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh iapfiqkfdflsdadkklifednarkvfnlev
Timeline for d5vn5a_: