SCOPe 2.08: Domain d5teob_: 5teo B:

Lineage for d5teob_ (5teo B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (3 species)

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [346174] (1 PDB entry)

8. Domain d5teob_: 5teo B: [339615]
   automated match to d2xt1a_

Details for d5teob_

PDB Entry: 5teo, 2.05 Å

PDB Description: dimer of hiv-1 gag ctd-sp1 fragment

PDB Compounds: (B:) HIV-1 Gag CTD-SP1

SCOPe Domain Sequences for d5teob_:

Sequence; same for both SEQRES and ATOM records:

>d5teob_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
atleemmtacqgvggpghkarvlaeamsqvtnt

Timeline for d5teob_:

• d5teob_ first appeared in SCOPe 2.06
  
• d5teob_ appears in SCOPe 2.07