Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
Domain d5o0wf1: 5o0w F:6-135 [339590] Other proteins in same PDB: d5o0wa_, d5o0wb_, d5o0wc_, d5o0wd_, d5o0we2, d5o0we3, d5o0wf2, d5o0wf3, d5o0wg2, d5o0wg3, d5o0wh2, d5o0wh3 automated match to d4dkaa_ complexed with gol |
PDB Entry: 5o0w (more details), 2.57 Å
SCOPe Domain Sequences for d5o0wf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o0wf1 b.1.1.1 (F:6-135) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgartdya dsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctissdtyd ywgqgtqvtv
Timeline for d5o0wf1: