Lineage for d5o0wc_ (5o0w C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098943Species Trypanosoma congolense [TaxId:1068625] [339574] (1 PDB entry)
  8. 2098946Domain d5o0wc_: 5o0w C: [339581]
    Other proteins in same PDB: d5o0we1, d5o0we2, d5o0wf1, d5o0wf2, d5o0wg1, d5o0wg2, d5o0wh1, d5o0wh2
    automated match to d2qdha_
    complexed with gol

Details for d5o0wc_

PDB Entry: 5o0w (more details), 2.57 Å

PDB Description: crystal structure of the complex between nb474 and trypanosoma congolense fructose-1,6-bisphosphate aldolase
PDB Compounds: (C:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5o0wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o0wc_ c.1.10.0 (C:) automated matches {Trypanosoma congolense [TaxId: 1068625]}
srrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagiglsn
taehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdcg
leplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaetl
aryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllkp
nmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnnsp
lprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddkd

SCOPe Domain Coordinates for d5o0wc_:

Click to download the PDB-style file with coordinates for d5o0wc_.
(The format of our PDB-style files is described here.)

Timeline for d5o0wc_: