Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Trypanosoma congolense [TaxId:1068625] [339574] (1 PDB entry) |
Domain d5o0wc_: 5o0w C: [339581] Other proteins in same PDB: d5o0we1, d5o0we2, d5o0wf1, d5o0wf2, d5o0wg1, d5o0wg2, d5o0wh1, d5o0wh2 automated match to d2qdha_ complexed with gol |
PDB Entry: 5o0w (more details), 2.57 Å
SCOPe Domain Sequences for d5o0wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o0wc_ c.1.10.0 (C:) automated matches {Trypanosoma congolense [TaxId: 1068625]} srrvevlltqlpaynrlktpyeeelietakkmtapgkgllaadestgscskrfagiglsn taehrrqyralmlecagfeqyisgvilhdetvyqrastgetfpqllrrrgvvpgiktdcg leplvegadgeqmtagldgyvkrakkyyavgcrfckwrnvykiqngtvseavvrfnaetl aryavlsqlcglvpivepevmidgthdietcqrvsqhvwaevvsalhrhgvvwegcllkp nmvvpgaesgqtataeqvaeytvktlarvlppalpgvtflsgglsevmaseylnamnnsp lprpwkltfsyaralqssaikawggkssgvaagrrafmhrakmnslaqlgrynrgdddkd
Timeline for d5o0wc_: