Lineage for d5njwb_ (5njw B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231396Species Bradyrhizobium japonicum [TaxId:224911] [226051] (5 PDB entries)
  8. 2231406Domain d5njwb_: 5njw B: [339550]
    automated match to d3lvzb_
    complexed with bo3, edo, oh, peg, zn

Details for d5njwb_

PDB Entry: 5njw (more details), 1.25 Å

PDB Description: crystal structure of bjp-1 metallo beta-lactamase in complex with boric acid
PDB Compounds: (B:) Blr6230 protein

SCOPe Domain Sequences for d5njwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5njwb_ d.157.1.1 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
qtikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmi
kdniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgde
knedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlff
csgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgap
npfikpgelvtyatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d5njwb_:

Click to download the PDB-style file with coordinates for d5njwb_.
(The format of our PDB-style files is described here.)

Timeline for d5njwb_: