SCOPe 2.06: Domain d6b1oa2: 6b1o A:509-766

Lineage for d6b1oa2 (6b1o A:509-766)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)

8. Domain d6b1oa2: 6b1o A:509-766 [339491]
   Other proteins in same PDB: d6b1oa1, d6b1ob1
   automated match to d1orva2
   complexed with c8s, nag

Details for d6b1oa2

PDB Entry: 6b1o, 1.91 Å

PDB Description: the structure of dpp4 in complex with vildagliptin analog

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d6b1oa2:

Sequence; same for both SEQRES and ATOM records:

>d6b1oa2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d6b1oa2:

• d6b1oa2 is new in SCOPe 2.06-stable
  
• d6b1oa2 appears in SCOPe 2.07
  
• d6b1oa2 appears in the current release, SCOPe 2.08