Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (13 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries) |
Domain d5gxza2: 5gxz A:472-628 [339448] Other proteins in same PDB: d5gxza1, d5gxzb1 automated match to d1tf4a2 complexed with 7pe, br, ca, cl |
PDB Entry: 5gxz (more details), 2.05 Å
SCOPe Domain Sequences for d5gxza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gxza2 b.2.2.0 (A:472-628) automated matches {Clostridium thermocellum [TaxId: 1515]} effveaainqasdhfteikallnnrsswparlikdlsynyymdltevfeagysvddikvt igycesgmdveispithlydniyyikisyidgtnicpigqeqyaaelqfriaapqgtkfw dptndfsyqgltrelaktkympvfdgatkifgevpgg
Timeline for d5gxza2: