Lineage for d5xnla_ (5xnl A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027522Species Pea (Pisum sativum) [TaxId:3888] [339414] (1 PDB entry)
  8. 3027523Domain d5xnla_: 5xnl A: [339415]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnlb_, d5xnlc_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
    automated match to d2axta1
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnla_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (A:) Photosystem II protein D1

SCOPe Domain Sequences for d5xnla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnla_ f.26.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
enlwgrfcnwitstenrlyigwfgvlmiptlltatsvfiiafiaappvdidgirepvsgs
llygnniisgaiiptsaaiglhfypiweaasvdewlynggpyelivlhfllgvacymgre
welsfrlgmrpwiavaysapvaaatavfliypigqgsfsdgmplgisgtfnfmivfqaeh
nilmhpfhmlgvagvfggslfsamhgslvtsslirettenesanegyrfgqeeetyniva
ahgyfgrlifqyasfnnsrslhfflaawpvvgiwftalgistmafnlngfnfnqsvvdsq
grvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d5xnla_:

Click to download the PDB-style file with coordinates for d5xnla_.
(The format of our PDB-style files is described here.)

Timeline for d5xnla_: