Lineage for d5xnlo_ (5xnl O:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3022041Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 3022042Protein automated matches [191257] (6 species)
    not a true protein
  7. 3022071Species Pea (Pisum sativum) [TaxId:3888] [339412] (1 PDB entry)
  8. 3022072Domain d5xnlo_: 5xnl O: [339413]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
    automated match to d4il6o_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlo_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (O:) Oxygen-evolving enhancer protein 1, chloroplastic

SCOPe Domain Sequences for d5xnlo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnlo_ f.4.1.0 (O:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
egapkrltfdeiqsktylevkgtgtanqcptidggvdsfsfkpgkynakklcleptsftv
ksegvtkntplafqntklmtrltytldeiegpfevsadgsvkfeekdgidyaavtvqlpg
gervpflftikqlvasgkpdsfsgeflvpsyrgssfldpkgrgastgydnavalpaggrg
deeelgkennksaasskgkitlsvtqtkpetgevigvfesiqpsdtdlgakapkdvkiqg
vwyaqles

SCOPe Domain Coordinates for d5xnlo_:

Click to download the PDB-style file with coordinates for d5xnlo_.
(The format of our PDB-style files is described here.)

Timeline for d5xnlo_: