![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.0: automated matches [191664] (1 protein) not a true family |
![]() | Protein automated matches [191257] (6 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [339412] (1 PDB entry) |
![]() | Domain d5xnlo_: 5xnl O: [339413] Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_ automated match to d4il6o_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnlo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnlo_ f.4.1.0 (O:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} egapkrltfdeiqsktylevkgtgtanqcptidggvdsfsfkpgkynakklcleptsftv ksegvtkntplafqntklmtrltytldeiegpfevsadgsvkfeekdgidyaavtvqlpg gervpflftikqlvasgkpdsfsgeflvpsyrgssfldpkgrgastgydnavalpaggrg deeelgkennksaasskgkitlsvtqtkpetgevigvfesiqpsdtdlgakapkdvkiqg vwyaqles
Timeline for d5xnlo_: