Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [339055] (1 PDB entry) |
Domain d6ay1e_: 6ay1 E: [339409] Other proteins in same PDB: d6ay1a2 automated match to d1ehwb_ complexed with hez, ipa, mpd |
PDB Entry: 6ay1 (more details), 2.05 Å
SCOPe Domain Sequences for d6ay1e_:
Sequence, based on SEQRES records: (download)
>d6ay1e_ d.58.6.0 (E:) automated matches {Helicobacter pylori [TaxId: 210]} kqrtlsiikpdalkkkvvgkiidrfesngleviamkrlhlsvkdaenfyaihrerpffkd liefmvsgpvvvmvlegkdavaknrdlmgatdpklaqkgtiradfaesidanavhgsdsl enahneiafffaardl
>d6ay1e_ d.58.6.0 (E:) automated matches {Helicobacter pylori [TaxId: 210]} kqrtlsiikpdalkkkvvgkiidrfesngleviamkrlhlsvkdaenfyaihrerpffkd liefmvsgpvvvmvlegkdavaknrdlmgatdpklagtiradfaesidanavhgsdslen ahneiafffaardl
Timeline for d6ay1e_: