Lineage for d6ay1e_ (6ay1 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951766Species Helicobacter pylori [TaxId:210] [339055] (1 PDB entry)
  8. 2951771Domain d6ay1e_: 6ay1 E: [339409]
    Other proteins in same PDB: d6ay1a2
    automated match to d1ehwb_
    complexed with hez, ipa, mpd

Details for d6ay1e_

PDB Entry: 6ay1 (more details), 2.05 Å

PDB Description: crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori
PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6ay1e_:

Sequence, based on SEQRES records: (download)

>d6ay1e_ d.58.6.0 (E:) automated matches {Helicobacter pylori [TaxId: 210]}
kqrtlsiikpdalkkkvvgkiidrfesngleviamkrlhlsvkdaenfyaihrerpffkd
liefmvsgpvvvmvlegkdavaknrdlmgatdpklaqkgtiradfaesidanavhgsdsl
enahneiafffaardl

Sequence, based on observed residues (ATOM records): (download)

>d6ay1e_ d.58.6.0 (E:) automated matches {Helicobacter pylori [TaxId: 210]}
kqrtlsiikpdalkkkvvgkiidrfesngleviamkrlhlsvkdaenfyaihrerpffkd
liefmvsgpvvvmvlegkdavaknrdlmgatdpklagtiradfaesidanavhgsdslen
ahneiafffaardl

SCOPe Domain Coordinates for d6ay1e_:

Click to download the PDB-style file with coordinates for d6ay1e_.
(The format of our PDB-style files is described here.)

Timeline for d6ay1e_: