![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Ctenopharyngodon idella [TaxId:7959] [189272] (2 PDB entries) |
![]() | Domain d5y91b_: 5y91 B: [339402] automated match to d3gbla_ |
PDB Entry: 5y91 (more details), 1.9 Å
SCOPe Domain Sequences for d5y91b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y91b_ b.1.1.0 (B:) automated matches {Ctenopharyngodon idella [TaxId: 7959]} kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm
Timeline for d5y91b_: