SCOPe 2.06: Domain d5xxyl1: 5xxy L:1-106

Lineage for d5xxyl1 (5xxy L:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5xxyl1: 5xxy L:1-106 [339382]
   Other proteins in same PDB: d5xxyl2
   automated match to d1dn0a1

Details for d5xxyl1

PDB Entry: 5xxy, 2.9 Å

PDB Description: crystal structure of pd-l1 complexed with atezolizumab fab at 2.9a

PDB Compounds: (L:) light chain of atezolizumab fab

SCOPe Domain Sequences for d5xxyl1:

Sequence; same for both SEQRES and ATOM records:

>d5xxyl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqylyhpatfgqgtkvei

Timeline for d5xxyl1:

• d5xxyl1 is new in SCOPe 2.06-stable
  
• d5xxyl1 appears in SCOPe 2.07
  
• d5xxyl1 appears in the current release, SCOPe 2.08