Lineage for d5w57b_ (5w57 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912798Species Paracoccus denitrificans [TaxId:318586] [270856] (4 PDB entries)
  8. 2912806Domain d5w57b_: 5w57 B: [339362]
    automated match to d3hh8a_
    complexed with zn

Details for d5w57b_

PDB Entry: 5w57 (more details), 2.3 Å

PDB Description: structure of holo aztc
PDB Compounds: (B:) Periplasmic solute binding protein

SCOPe Domain Sequences for d5w57b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w57b_ c.92.2.0 (B:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
epldvvatfsiigdfaakvggdrirlnvlvgpdsdthvyeprpadaialagadvvltngl
efegfltrliaasgtdaavatltdgvetmeepggghyhyidgkavfhagahdphawqavp
nakvyvqniaaafcaadaegcaayqanaaryigeldaldteiraaiaalpqdrrtvvvah
nafryfeaaygvhflspqgvsteseaaaadvaglireirarnasaifaenisdtrlleqi
areaglplagtlysdalsgpdgpasnyiammrhnagaiaaalaa

SCOPe Domain Coordinates for d5w57b_:

Click to download the PDB-style file with coordinates for d5w57b_.
(The format of our PDB-style files is described here.)

Timeline for d5w57b_: