Lineage for d5vida1 (5vid A:863-1066)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374399Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2374400Protein Botulinum neurotoxin [49959] (2 species)
  7. 2374401Species Clostridium botulinum, serotype A [TaxId:1491] [49960] (6 PDB entries)
  8. 2374408Domain d5vida1: 5vid A:863-1066 [339356]
    Other proteins in same PDB: d5vida2, d5vidb2, d5vidc2, d5vidd2, d5vide2
    automated match to d2nm1a1

Details for d5vida1

PDB Entry: 5vid (more details), 2.75 Å

PDB Description: receptor binding domain of bont/b in complex with mini-protein binder bot.0671.2
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d5vida1:

Sequence, based on SEQRES records: (download)

>d5vida1 b.29.1.6 (A:863-1066) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntel

Sequence, based on observed residues (ATOM records): (download)

>d5vida1 b.29.1.6 (A:863-1066) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqsvfldfsvs
fwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingktksvffey
nirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiifkldgdid
rtqfiwmkyfsifntel

SCOPe Domain Coordinates for d5vida1:

Click to download the PDB-style file with coordinates for d5vida1.
(The format of our PDB-style files is described here.)

Timeline for d5vida1: