SCOPe 2.08: Domain d5usll2: 5usl L:109-211

Lineage for d5usll2 (5usl L:109-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5usll2: 5usl L:109-211 [339338]
   Other proteins in same PDB: d5usla_, d5uslb_, d5uslh_, d5uslx_
   automated match to d4npya2

Details for d5usll2

PDB Entry: 5usl, 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv304

PDB Compounds: (L:) Fab vv304 Light chain

SCOPe Domain Sequences for d5usll2:

Sequence; same for both SEQRES and ATOM records:

>d5usll2 b.1.1.0 (L:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnsyaassylsltpeqwkshrsyscqvthegstvektmaha

Timeline for d5usll2:

• d5usll2 first appeared in SCOPe 2.06
  
• d5usll2 appears in SCOPe 2.07