Lineage for d5usla_ (5usl A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078950Species Vaccinia virus [TaxId:10245] [256246] (6 PDB entries)
  8. 2078956Domain d5usla_: 5usl A: [339328]
    Other proteins in same PDB: d5uslc1, d5uslc2, d5usll1, d5usll2
    automated match to d4etqx_

Details for d5usla_

PDB Entry: 5usl (more details), 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv304
PDB Compounds: (A:) IMV membrane protein

SCOPe Domain Sequences for d5usla_:

Sequence, based on SEQRES records: (download)

>d5usla_ b.74.1.0 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
iifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyys

Sequence, based on observed residues (ATOM records): (download)

>d5usla_ b.74.1.0 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
iifptpinihsdqlskfrtllslphyitenyrnpyklnddtevyys

SCOPe Domain Coordinates for d5usla_:

Click to download the PDB-style file with coordinates for d5usla_.
(The format of our PDB-style files is described here.)

Timeline for d5usla_: