SCOPe 2.08: Domain d5ushe2: 5ush E:114-213

Lineage for d5ushe2 (5ush E:114-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5ushe2: 5ush E:114-213 [339327]
Other proteins in same PDB: d5usha_, d5ushd_, d5ushe1, d5ushh_, d5ushl1, d5ushx1, d5ushx2
automated match to d4d9ll2

Details for d5ushe2

PDB Entry: 5ush (more details), 2.3 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv66

PDB Compounds: (E:) Fab vv66 light chain

SCOPe Domain Sequences for d5ushe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ushe2 b.1.1.2 (E:114-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5ushe2:

Click to download the PDB-style file with coordinates for d5ushe2.
(The format of our PDB-style files is described here.)

Timeline for d5ushe2: