Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5ushe2: 5ush E:114-213 [339327] Other proteins in same PDB: d5usha_, d5ushd_, d5ushe1, d5ushh_, d5ushl1, d5ushx1, d5ushx2 automated match to d4d9ll2 |
PDB Entry: 5ush (more details), 2.3 Å
SCOPe Domain Sequences for d5ushe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ushe2 b.1.1.2 (E:114-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqs nnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d5ushe2: