Lineage for d5ushe1 (5ush E:2-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033476Domain d5ushe1: 5ush E:2-113 [339326]
    Other proteins in same PDB: d5usha_, d5ushe2, d5ushl2, d5ushx1, d5ushx2
    automated match to d4d9ll1

Details for d5ushe1

PDB Entry: 5ush (more details), 2.3 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv66
PDB Compounds: (E:) Fab vv66 light chain

SCOPe Domain Sequences for d5ushe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ushe1 b.1.1.0 (E:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygninrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsslsgalfgggtqltvlgq

SCOPe Domain Coordinates for d5ushe1:

Click to download the PDB-style file with coordinates for d5ushe1.
(The format of our PDB-style files is described here.)

Timeline for d5ushe1: