SCOPe 2.06: Domain d5usha_: 5ush A:

Lineage for d5usha_ (5ush A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (13 species)
   not a true protein

7. Species Vaccinia virus [TaxId:10245] [256246] (6 PDB entries)

8. Domain d5usha_: 5ush A: [339323]
   Other proteins in same PDB: d5ushe1, d5ushe2, d5ushl1, d5ushl2, d5ushx2
   automated match to d4etqx_

Details for d5usha_

PDB Entry: 5ush, 2.3 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv66

PDB Compounds: (A:) IMV membrane protein

SCOPe Domain Sequences for d5usha_:

Sequence, based on SEQRES records:

>d5usha_ b.74.1.0 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
iifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyys

Sequence, based on observed residues (ATOM records):

>d5usha_ b.74.1.0 (A:) automated matches {Vaccinia virus [TaxId: 10245]}
qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
iifptpinihsdqlskfrtllsyitenyrnpyklnddtevyys

Timeline for d5usha_:

• d5usha_ is new in SCOPe 2.06-stable
  
• d5usha_ appears in SCOPe 2.07
  
• d5usha_ appears in the current release, SCOPe 2.08