Lineage for d5u65b_ (5u65 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2023922Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2023974Domain d5u65b_: 5u65 B: [339320]
    automated match to d4w81a_
    complexed with so4

Details for d5u65b_

PDB Entry: 5u65 (more details), 2.3 Å

PDB Description: camel nanobody vhh-5
PDB Compounds: (B:) vhh-5

SCOPe Domain Sequences for d5u65b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u65b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlqesgggsvqaggslrlscvvsgltisnycmrwfrqapgkgregvasinsagttyya
dsvkgrftmsrdnakntvyldmnslkpedtaiyycasstrvwggycgglddatnndwgqg
tqvtvss

SCOPe Domain Coordinates for d5u65b_:

Click to download the PDB-style file with coordinates for d5u65b_.
(The format of our PDB-style files is described here.)

Timeline for d5u65b_: