Lineage for d5u99a2 (5u99 A:211-284)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951016Species Mycobacterium tuberculosis [TaxId:83332] [335658] (3 PDB entries)
  8. 2951019Domain d5u99a2: 5u99 A:211-284 [339313]
    Other proteins in same PDB: d5u99a1, d5u99a3
    automated match to d1nh8a2
    complexed with atp, mg, so4

Details for d5u99a2

PDB Entry: 5u99 (more details), 2.4 Å

PDB Description: transition state analysis of adenosine triphosphate phosphoribosyltransferase
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5u99a2:

Sequence, based on SEQRES records: (download)

>d5u99a2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf

Sequence, based on observed residues (ATOM records): (download)

>d5u99a2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qylmldydcprsalkkataitpglesptiapdpdwvairalvprrdvngimdelaaigak
ailasdirfcrf

SCOPe Domain Coordinates for d5u99a2:

Click to download the PDB-style file with coordinates for d5u99a2.
(The format of our PDB-style files is described here.)

Timeline for d5u99a2: