Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [335658] (3 PDB entries) |
Domain d5u99a2: 5u99 A:211-284 [339313] Other proteins in same PDB: d5u99a1, d5u99a3 automated match to d1nh8a2 complexed with atp, mg, so4 |
PDB Entry: 5u99 (more details), 2.4 Å
SCOPe Domain Sequences for d5u99a2:
Sequence, based on SEQRES records: (download)
>d5u99a2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig akailasdirfcrf
>d5u99a2 d.58.5.0 (A:211-284) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} qylmldydcprsalkkataitpglesptiapdpdwvairalvprrdvngimdelaaigak ailasdirfcrf
Timeline for d5u99a2: