Lineage for d5ocal2 (5oca L:113-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (950 PDB entries)
  8. 2353170Domain d5ocal2: 5oca L:113-214 [339291]
    Other proteins in same PDB: d5ocal1
    automated match to d1aqkl2
    complexed with 9qz, na

Details for d5ocal2

PDB Entry: 5oca (more details), 2.3 Å

PDB Description: pcsk9:fab complex with dextran sulfate
PDB Compounds: (L:) Fab from LDLR competitive antibody: Light chain

SCOPe Domain Sequences for d5ocal2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocal2 b.1.1.2 (L:113-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5ocal2:

Click to download the PDB-style file with coordinates for d5ocal2.
(The format of our PDB-style files is described here.)

Timeline for d5ocal2: