Lineage for d5ocal1 (5oca L:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742700Domain d5ocal1: 5oca L:1-112 [339290]
    Other proteins in same PDB: d5ocab1, d5ocab2, d5ocal2
    automated match to d1aqkl1
    complexed with na, twa, twd

Details for d5ocal1

PDB Entry: 5oca (more details), 2.3 Å

PDB Description: pcsk9:fab complex with dextran sulfate
PDB Compounds: (L:) Fab from LDLR competitive antibody: Light chain

SCOPe Domain Sequences for d5ocal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocal1 b.1.1.1 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapkllisgnsnrpsgv
pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlg

SCOPe Domain Coordinates for d5ocal1:

Click to download the PDB-style file with coordinates for d5ocal1.
(The format of our PDB-style files is described here.)

Timeline for d5ocal1: