Lineage for d1diab2 (1dia B:1002-1126)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317634Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 317635Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 317752Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)
  6. 317753Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
    the two-domain organisation is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 317759Species Human (Homo sapiens) [TaxId:9606] [53237] (4 PDB entries)
  8. 317765Domain d1diab2: 1dia B:1002-1126 [33929]
    Other proteins in same PDB: d1diaa1, d1diab1
    complexed with l24, nap

Details for d1diab2

PDB Entry: 1dia (more details), 2.2 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly249543

SCOP Domain Sequences for d1diab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diab2 c.58.1.2 (B:1002-1126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOP Domain Coordinates for d1diab2:

Click to download the PDB-style file with coordinates for d1diab2.
(The format of our PDB-style files is described here.)

Timeline for d1diab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diab1