Lineage for d5nw1a_ (5nw1 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177284Domain d5nw1a_: 5nw1 A: [339259]
    Other proteins in same PDB: d5nw1b1, d5nw1b2, d5nw1c_, d5nw1e1, d5nw1e2, d5nw1f_, d5nw1h1, d5nw1h2, d5nw1i_, d5nw1k1, d5nw1k2, d5nw1l_
    automated match to d1lqba_
    complexed with 9bh

Details for d5nw1a_

PDB Entry: 5nw1 (more details), 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- (cyclobutanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4- methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 18)
PDB Compounds: (A:) Elongin-B

SCOPe Domain Sequences for d5nw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw1a_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d5nw1a_:

Click to download the PDB-style file with coordinates for d5nw1a_.
(The format of our PDB-style files is described here.)

Timeline for d5nw1a_: