Lineage for d5nw0j_ (5nw0 J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931306Domain d5nw0j_: 5nw0 J: [339256]
    Other proteins in same PDB: d5nw0b1, d5nw0b2, d5nw0c_, d5nw0e1, d5nw0e2, d5nw0f_, d5nw0h1, d5nw0h2, d5nw0i_, d5nw0k1, d5nw0k2, d5nw0l_
    automated match to d1lqba_
    complexed with 9bk

Details for d5nw0j_

PDB Entry: 5nw0 (more details), 2.3 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-(1- acetamidocyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n- (4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 17)
PDB Compounds: (J:) Elongin-B

SCOPe Domain Sequences for d5nw0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw0j_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5nw0j_:

Click to download the PDB-style file with coordinates for d5nw0j_.
(The format of our PDB-style files is described here.)

Timeline for d5nw0j_: