SCOPe 2.07: Domain d5nw1b1: 5nw1 B:17-112

Lineage for d5nw1b1 (5nw1 B:17-112)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (52 PDB entries)

8. Domain d5nw1b1: 5nw1 B:17-112 [339254]
   Other proteins in same PDB: d5nw1a_, d5nw1b2, d5nw1c_, d5nw1d_, d5nw1e2, d5nw1f_, d5nw1g_, d5nw1h2, d5nw1i_, d5nw1j_, d5nw1k2, d5nw1l_
   automated match to d1lm8c_
   complexed with 9bh

Details for d5nw1b1

PDB Entry: 5nw1, 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- (cyclobutanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4- methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 18)

PDB Compounds: (B:) Elongin-C

SCOPe Domain Sequences for d5nw1b1:

Sequence, based on SEQRES records:

>d5nw1b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d5nw1b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

Timeline for d5nw1b1:

• d5nw1b1 first appeared in SCOPe 2.06