Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (16 species) not a true protein |
Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries) |
Domain d5nz2a_: 5nz2 A: [339237] automated match to d3zeza_ complexed with dup, mg; mutant |
PDB Entry: 5nz2 (more details), 2.85 Å
SCOPe Domain Sequences for d5nz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nz2a_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]} tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll tsrsgvsskthlvietgkidagyhgnlginikneheddkmqtiflrnidnekifekerhl yklgsyriekgeriaqlvivpiwtpelkqveefes
Timeline for d5nz2a_: