Lineage for d5nz2a_ (5nz2 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083499Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2083500Protein automated matches [191182] (16 species)
    not a true protein
  7. 2083700Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries)
  8. 2083711Domain d5nz2a_: 5nz2 A: [339237]
    automated match to d3zeza_
    complexed with dup, mg; mutant

Details for d5nz2a_

PDB Entry: 5nz2 (more details), 2.85 Å

PDB Description: twist and induce: dissecting the link between the enzymatic activity and the sapi inducing capacity of the phage 80 dutpase. d95e mutant from dutpase 80alpha phage.
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d5nz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nz2a_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagyhgnlginikneheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefes

SCOPe Domain Coordinates for d5nz2a_:

Click to download the PDB-style file with coordinates for d5nz2a_.
(The format of our PDB-style files is described here.)

Timeline for d5nz2a_: