Lineage for d1bw9a2 (1bw9 A:1-148)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72517Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 72518Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 72519Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 72588Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 72589Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 72594Domain d1bw9a2: 1bw9 A:1-148 [33922]
    Other proteins in same PDB: d1bw9a1, d1bw9b1

Details for d1bw9a2

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate

SCOP Domain Sequences for d1bw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9a2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysnladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOP Domain Coordinates for d1bw9a2:

Click to download the PDB-style file with coordinates for d1bw9a2.
(The format of our PDB-style files is described here.)

Timeline for d1bw9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9a1