Lineage for d5nw1k1 (5nw1 K:17-112)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513355Protein Elongin C [54699] (3 species)
  7. 2513358Species Human (Homo sapiens) [TaxId:9606] [54700] (52 PDB entries)
  8. 2513408Domain d5nw1k1: 5nw1 K:17-112 [339215]
    Other proteins in same PDB: d5nw1a_, d5nw1b2, d5nw1c_, d5nw1d_, d5nw1e2, d5nw1f_, d5nw1g_, d5nw1h2, d5nw1i_, d5nw1j_, d5nw1k2, d5nw1l_
    automated match to d1lm8c_
    complexed with 9bh

Details for d5nw1k1

PDB Entry: 5nw1 (more details), 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- (cyclobutanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4- methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 18)
PDB Compounds: (K:) Elongin-C

SCOPe Domain Sequences for d5nw1k1:

Sequence, based on SEQRES records: (download)

>d5nw1k1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d5nw1k1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d5nw1k1:

Click to download the PDB-style file with coordinates for d5nw1k1.
(The format of our PDB-style files is described here.)

Timeline for d5nw1k1: