Lineage for d5nvwj_ (5nvw J:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177315Domain d5nvwj_: 5nvw J: [339203]
    Other proteins in same PDB: d5nvwb1, d5nvwb2, d5nvwc_, d5nvwe1, d5nvwe2, d5nvwf_, d5nvwh1, d5nvwh2, d5nvwi_, d5nvwk1, d5nvwk2, d5nvwl_
    automated match to d1lqba_
    complexed with 9bw

Details for d5nvwj_

PDB Entry: 5nvw (more details), 2.2 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- (cyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4- methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
PDB Compounds: (J:) Elongin-B

SCOPe Domain Sequences for d5nvwj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvwj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5nvwj_:

Click to download the PDB-style file with coordinates for d5nvwj_.
(The format of our PDB-style files is described here.)

Timeline for d5nvwj_: